Overview

  • Product nameAnti-ENSA antibody
    See all ENSA primary antibodies
  • Description
    Chicken polyclonal to ENSA
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Cow, Human
  • Immunogen

    Full length protein corresponding to Human ENSA aa 1-121.
    Sequence:

    MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGG SDFLMKRLQK GQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIP TPQDLPQRKSSLVTSKLAGGQV E

  • General notesDuring shipment, small volumes of product will occasionally become entrapped in the seal of the product vial. For products with volumes of 200 µL or less, we recommend gently tapping the vial on a hard surface or briefly centrifuging the vial in a tabletop centrifuge to dislodge any liquid in the container's cap.

Properties

Applications

Our Abpromise guarantee covers the use of ab14297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 15 kDa.

Target

  • RelevanceENSA (Alpha endosulfine) is expressed in a wide range of tissues including muscle, brain, and endocrine tissues. The recombinant protein inhibits binding of labeled glibenclamide to beta cell membranes. It also inhibits cloned K(ATP) channel currents and thereby stimulates insulin secretion. It was proposed that endosulfine is an endogenous regulator of the K(ATP) channel, which has a key role in the control of insulin release and, more generally, couples cell metabolism to electrical activity.
  • Cellular localizationCytoplasmic
  • Database links
  • Alternative names
    • Alpha endosulfine antibody
    • ARPP 19e antibody
    • Endosulfine alpha antibody

Anti-ENSA antibody images

  • Anti-ENSA antibody (ab14297) at 1/2000 dilution + E.coli derived ENSA fusion protein as test antigen.

    Secondary
    HRP conjugated goat anti IgY at 1/1000 dilution

    Predicted band size : 15 kDa

References for Anti-ENSA antibody (ab14297)

This product has been referenced in:
  • Woods WS  et al. Conformation-specific binding of alpha-synuclein to novel protein partners detected by phage display and NMR spectroscopy. J Biol Chem 282:34555-67 (2007). WB ; Human . Read more (PubMed: 17893145) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab14297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"