Overview

  • Product name
    Anti-Enterovirus 71 antibody
    See all Enterovirus 71 primary antibodies
  • Description
    Mouse polyclonal to Enterovirus 71
  • Host species
    Mouse
  • Specificity
    This antibody is specific for the Protein VP1 cleaved chain of Genome polyprotein. The complete proteome is Human enterovirus 71 (Ev 71).
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Other
  • Immunogen

    Full length protein corresponding to Enterovirus 71 aa 1-297. The immunogen is EV71 Protein VP1. This cleaved chain is 297 aa in length and can be found from aa 566 to 862 in the complete proteome of human enterovirus 71 (EV 71)
    Sequence:

    GDRVADVIESSIGDSVSKALTPALPAPTGPDTQVSSHRLDTGKVPALQAA EIGASSNASDESMIETRCVLNSHSTAETTLDSFFSRAGLVGEIDLPLKGT TNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGRVVPQL LQYMFVPPGAPKPDSRDSLAWPTATNPSVFVKSSDPPAQVSVPFMSPASA YQWFYDGYPTFGEHKQEKDLEYGACPNNMMGTFSVRTVGSSKSEYSLVIR IYMRMKHVRAWIPRPMRNQNYLFKSNPNYAGDSIKPTGTSRTAITTL


    Database link: Q66478

  • Positive control
    • Enterovirus 71 transfected 293T lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer
    pH: 7.20
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab169442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa.

Target

  • Relevance
    Enterovirus 71 was first isolated in 1969. Since then it has been associated with sporadic cases of outbreaks in various parts of the world, including the U.S., Brazil, Europe, Austrailia, Malaysia, and Taiwan. Entervirus 71 infection may present itself much like other enterovirus infections, with symptoms ranging from asymptomatic to the presentation of rashes, diarrhea, colds, meningitis, encephalitis, hand to foot to mouth disease, myocarditis, or some combination of these syndromes. On the other hand, Enterovirus 71 may cause many unusal syndromes such as acute flaccid paralysis (similar to paralytic poliomyelitis), bulbar and brain encephalitis, Guillain Barre syndrome, and rapidly fatal pulmonary edema and hemmorrhage.
  • Alternative names
    • EV71 antibody

Images

  • All lanes : Anti-Enterovirus 71 antibody (ab169442) at 1 µg/ml

    Lane 1 : Enterovirus 71 transfected lysate
    Lane 2 : Non-transfected lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 33 kDa

References

This product has been referenced in:
  • Zhou B  et al. Hsa-let-7c-5p augments enterovirus 71 replication through viral subversion of cell signaling in rhabdomyosarcoma cells. Cell Biosci 7:7 (2017). Read more (PubMed: 28101327) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up