Overview

  • Product name
  • Description
    Rabbit polyclonal to ENTPD2
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 92 - 122 (

    ASQSLVGCLEQALQDVPKERHAGTPLYLGAT

    ) of Human ENTPD2 (Q9Y5L3), conjugated to KLH.

  • Positive control
    • WB: K562 cell lysate; IHC-P: brain tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer
    Preservative: 0.09% Sodium Azide
    Constituents: PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab102651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500. Predicted molecular weight: 54 kDa.
IHC-P 1/50 - 1/100. Perform heat mediated antigen retrieval before commencing with IHC staining protocol. Use citrate buffer pH 6.

Target

  • Function
    In the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Hydrolyzes ADP only to a marginal extent. The order of activity with different substrates is ATP > GTP > CTP = ITP > UTP >> ADP = UDP.
  • Tissue specificity
    Brain, placenta, skeletal muscle, kidney, pancreas, heart, ovary, testis, colon, small intestine, prostate and pancreas. No expression in adult thymus, spleen, lung, liver and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the GDA1/CD39 NTPase family.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • NTPDase 2 antibody
    • NTPDase2 antibody
    • CD39 antigen like 1 antibody
    • CD39 antigen-like 1 antibody
    • CD39 like1 antibody
    • CD39L1 antibody
    • CD39like1 antibody
    • ecto ATP diphosphohydrolase 2 antibody
    • ecto ATPase 2 antibody
    • ecto ATPDase 2 antibody
    • Ecto-ATP diphosphohydrolase 2 antibody
    • Ecto-ATPase 2 antibody
    • Ecto-ATPDase 2 antibody
    • ectoATPase 2 antibody
    • ectoATPDase 2 antibody
    • Ectonucleoside triphosphate diphosphohydrolase 2 antibody
    • ENTP2_HUMAN antibody
    • Entpd2 antibody
    • NTPDase 2 antibody
    see all

Images

  • Anti-ENTPD2 antibody (ab102651) at 1/100 dilution + K562 cell lysate at 35 µg

    Predicted band size : 54 kDa
  • 1/50 ab102651 staining ENTPD2 in formalin-fixed, paraffin-embedded Human brain tissue.

References

ab102651 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up