Overview

  • Product nameAnti-ENTPD2 antibody
    See all ENTPD2 primary antibodies
  • Description
    Rabbit polyclonal to ENTPD2
  • Tested applicationsSuitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 92 - 122 (

    ASQSLVGCLEQALQDVPKERHAGTPLYLGAT

    ) of Human ENTPD2 (Q9Y5L3), conjugated to KLH.

  • Positive control
    • WB: K562 cell lysate; IHC-P: brain tissue.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferPreservative: 0.09% Sodium Azide
    Constituents: PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab102651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500. Predicted molecular weight: 54 kDa.
IHC-P 1/50 - 1/100. Perform heat mediated antigen retrieval before commencing with IHC staining protocol. Use citrate buffer pH 6.

Target

  • FunctionIn the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Hydrolyzes ADP only to a marginal extent. The order of activity with different substrates is ATP > GTP > CTP = ITP > UTP >> ADP = UDP.
  • Tissue specificityBrain, placenta, skeletal muscle, kidney, pancreas, heart, ovary, testis, colon, small intestine, prostate and pancreas. No expression in adult thymus, spleen, lung, liver and peripheral blood leukocytes.
  • Sequence similaritiesBelongs to the GDA1/CD39 NTPase family.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • NTPDase 2 antibody
    • NTPDase2 antibody
    • CD39 antigen like 1 antibody
    • CD39 antigen-like 1 antibody
    • CD39 like1 antibody
    • CD39L1 antibody
    • CD39like1 antibody
    • ecto ATP diphosphohydrolase 2 antibody
    • ecto ATPase 2 antibody
    • ecto ATPDase 2 antibody
    • Ecto-ATP diphosphohydrolase 2 antibody
    • Ecto-ATPase 2 antibody
    • Ecto-ATPDase 2 antibody
    • ectoATPase 2 antibody
    • ectoATPDase 2 antibody
    • Ectonucleoside triphosphate diphosphohydrolase 2 antibody
    • ENTP2_HUMAN antibody
    • Entpd2 antibody
    • NTPDase 2 antibody
    see all

Anti-ENTPD2 antibody images

  • Anti-ENTPD2 antibody (ab102651) at 1/100 dilution + K562 cell lysate at 35 µg

    Predicted band size : 54 kDa
  • 1/50 ab102651 staining ENTPD2 in formalin-fixed, paraffin-embedded Human brain tissue.

References for Anti-ENTPD2 antibody (ab102651)

ab102651 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"