Overview

  • Product name
  • Description
    Rabbit polyclonal to EPC1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human EPC1 aa 1-836.
    Sequence:

    MSKLSFRARALDASKPLPVFRCEDLPDLHEYASINRAVPQMPTGMEKEEE SEHHLQRAISAQQVYGEKRDNMVIPVPEAESNIAYYESIYPGEFKMPKQL IHIQPFSLDAEQPDYDLDSEDEVFVNKLKKKMDICPLQFEEMIDRLEKGS GQQPVSLQEAKLLLKEDDELIREVYEYWIKKRKNCRGPSLIPSVKQEKRD GSSTNDPYVAFRRRTEKMQTRKNRKNDEASYEKMLKLRRDLSRAVTILEM IKRREKSKRELLHLTLEIMEKRYNLGDYNGEIMSEVMAQRQPMKPTYAIP IIPITNSSQFKHQEAMDVKEFKVNKQDKADLIRPKRKYEKKPKVLPSSAA ATPQQTSPAALPVFNAKDLNQYDFPSSDEEPLSQVLSGSSEAEEDNDPDG PFAFRRKAGCQYYAPHLDQTGNWPWTSPKDGGLGDVRYRYCLTTLTVPQR CIGFARRRVGRGGRVLLDRAHSDYDSVFHHLDLEMLSSPQHSPVNQFANT SETNTSDKSFSKDLSQILVNIKSCRWRHFRPRTPSLHDSDNDELSCRKLY RSINRTGTAQPGTQTCSTSTQSKSSSGSAHFAFTAEQYQQHQQQLALMQK QQLAQIQQQQANSNSSTNTSQNLASNQQKSGFRLNIQGLERTLQGFVSKT LDSASAQFAASALVTSEQLMGFKMKDDVVLGIGVNGVLPASGVYKGLHLS STTPTALVHTSPSTAGSALLQPSNITQTSSSHSALSHQVTAANSATTQVL IGNNIRLTVPSSVATVNSIAPINARHIPRTLSAVPSSALKLAAAANCQVS KVPSSSSVDSVPRENHESEKPALNNIADNTVAMEVT


    Database link: Q9H2F5

Properties

Applications

Our Abpromise guarantee covers the use of ab192518 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 93 kDa.
IHC-P Use at an assay dependent concentration.

Target

  • Function
    Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage.
  • Sequence similarities
    Belongs to the enhancer of polycomb family.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp781P2312 antibody
    • Enhancer of polycomb 1 antibody
    • Enhancer of polycomb homolog 1 (Drosophila) antibody
    • Enhancer of polycomb homolog 1 antibody
    • EPC1 antibody
    • EPC1_HUMAN antibody
    • Epl 1 antibody
    • Epl1 antibody
    • OTTHUMP00000046260 antibody
    see all

References

ab192518 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192518.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up