Overview

  • Product nameAnti-Ephrin A2 antibody
    See all Ephrin A2 primary antibodies
  • Description
    Rabbit polyclonal to Ephrin A2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Guinea pig, Cow
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 76-125 (

    YGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLK

    ) of Human Ephrin A2 (NP_001396).

  • Positive control
    • Human placenta lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab116035 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-Ephrin A2 antibody images

  • Anti-Ephrin A2 antibody (ab116035) at 1 µg/ml + placenta lysate at 10 µg

    Predicted band size : 24 kDa

References for Anti-Ephrin A2 antibody (ab116035)

ab116035 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116035.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"