Anti-EPO Receptor antibody [VP2E8] (ab180791)

Overview

  • Product name
    Anti-EPO Receptor antibody [VP2E8]
  • Description
    Mouse monoclonal [VP2E8] to EPO Receptor
  • Host species
    Mouse
  • Tested applications
    Suitable for: Flow Cyt, Competitive ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Other Immunogen Type corresponding to Human EPO Receptor (extracellular). Genetic immunisation with cDNA encoding the Extracellular domain of Human EPO Receptor
    Sequence:

    APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGP GNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRV TAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPM TSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARM AEPSFGGFWSAWSEPVSLLTPSDLDPLILTLSLILVVILVLLTVLALLSH RRALKQKIWPGIPSPESEFEGLFTTHKGNFQLWLYQNDGCLWWSPCTPFT EDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVGSEHAQDTYLVLDKW LLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGASAASF EYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQ GAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS


    Database link: P19235

  • Positive control
    • BOSC23 cells transiently transfected with EPO receptor

Properties

Applications

Our Abpromise guarantee covers the use of ab180791 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use 1.2µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

Competitive ELISA 1/200 - 1/400.

Target

  • Function
    Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate the LYN tyrosine kinase.
    Isoform EPOR-T acts as a dominant-negative receptor of EPOR-mediated signaling.
  • Tissue specificity
    Erythroid cells and erythroid progenitor cells. Isoform EPOR-F is the most abundant form in EPO-dependent erythroleukemia cells and in late-stage erythroid progenitors. Isoform EPOR-S and isoform EPOR-T are the predominant forms in bone marrow. Isoform EPOR-T is the most abundant from in early-stage erythroid progenitor cells.
  • Involvement in disease
    Defects in EPOR are the cause of erythrocytosis familial type 1 (ECYT1) [MIM:133100]. ECYT1 is an autosomal dominant disorder characterized by increased serum red blood cell mass, elevated hemoglobin and hematocrit, hypersensitivity of erythroid progenitors to erythropoietin, erythropoietin low serum levels, and no increase in platelets nor leukocytes. It has a relatively benign course and does not progress to leukemia.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 1 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications
    On EPO stimulation, phosphorylated on C-terminal tyrosine residues by JAK2. The phosphotyrosine motifs are also recruitment sites for several SH2-containing proteins and adapter proteins which mediate cell proliferation. Phosphorylation on Tyr-454 is required for PTPN6 interaction, Tyr-426 for PTPN11. Tyr-426 is also required for SOCS3 binding, but Tyr-454/Tyr-456 motif is the preferred binding site.
    Ubiquitinated by NOSIP; appears to be either multi-monoubiquitinated or polyubiquitinated. Ubiquitination mediates proliferation and survival of EPO-dependent cells.
  • Cellular localization
    Cell membrane and Secreted. Secreted and located to the cell surface.
  • Information by UniProt
  • Database links
  • Alternative names
    • EPO R antibody
    • EPO-R antibody
    • epor antibody
    • EPOR_HUMAN antibody
    • Erythropoietin receptor antibody
    • Erythropoietin receptor precursor antibody
    • MGC138358 antibody
    see all

Images

  • Flow cytometric staining of BOSC23 cells transiently transfected with an expression vector encoding either EPO Receptor (red curve) or an irrelevant protein black curve (control transfectant) labeling EPO receptor  with ab180791 at 1/200 dilution. A PE conjugated secondary antibody was used. A positive signal was obtained only with EPO receptor transfected cells.

  • Capillary Gel Electrophoresis (CGE) analysis of purified ab180791 monoclonal antibody. Lane 1: molecular weight marker, Lane 2: 2 μg of purified ab180791.  Internal control bands (240 kDa / 7 kDa / 4,5 kDa).

References

ab180791 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Flow Cytometry
Sample
Pig Cell (kidney)
Permeabilization
No
Specification
kidney
Fixation
Formaldehyde
Username

Abcam user community

Verified customer

Submitted Apr 25 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up