Anti-epsilon Tubulin antibody (ab98833)

Overview

  • Product nameAnti-epsilon Tubulin antibody
    See all epsilon Tubulin primary antibodies
  • Description
    Rabbit polyclonal to epsilon Tubulin
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 179-228 (

    PSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSG

    ) of Human epsilon Tubulin (NP_057346).

  • Positive control
    • MCF7 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab98833 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 53 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-epsilon Tubulin antibody images

  • Anti-epsilon Tubulin antibody (ab98833) at 1 µg/ml + MCF7 cell lysate at 10 µg

    Predicted band size : 53 kDa

References for Anti-epsilon Tubulin antibody (ab98833)

ab98833 has not yet been referenced specifically in any publications.

Product Wall

I have compared the sequence you sent to the immunogen sequence of ab98833 and ab11322 and neither of them have a high enough degree of similarity to your sequence of interest that I would be confident in recommending them to you. You could try lookin...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"