Overview

  • Product name
  • Description
    Mouse polyclonal to ERCC1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: African green monkey, Chinese hamster
  • Immunogen

    Synthetic peptide:

    SLPQPTRKKFVIPLEDEAPPAGAKPLFRSSRNPSTTAPSVPAAPQTYAEY AIAQPPGGAGPTGPTGSEPVKGENPGQTVKTGAKSNSILVSPRQRGNPVL

    , corresponding to amino acids 9/108 of Chinese Hamster ERCC1

  • General notes
    Produced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer
    Constituents: 50% Glycerol
  • Purity
    Whole antiserum
  • Primary antibody notes
    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab22193 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 32 kDa.

This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.

Target

  • Function
    Structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair.
  • Involvement in disease
    Defects in ERCC1 are the cause of cerebro-oculo-facio-skeletal syndrome type 4 (COFS4) [MIM:610758]. COFS is a degenerative autosomal recessive disorder of prenatal onset affecting the brain, eye and spinal cord. After birth, it leads to brain atrophy, hypoplasia of the corpus callosum, hypotonia, cataracts, microcornea, optic atrophy, progressive joint contractures and growth failure. Facial dysmorphism is a constant feature. Abnormalities of the skull, eyes, limbs, heart and kidney also occur.
  • Sequence similarities
    Belongs to the ERCC1/RAD10/SWI10 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Alternative names
    • COFS 4 antibody
    • COFS4 antibody
    • DNA excision repair protein ERCC 1 antibody
    • DNA excision repair protein ERCC-1 antibody
    • DNA excision repair protein ERCC1 antibody
    • ERCC 1 antibody
    • ERCC1 antibody
    • ERCC1_HUMAN antibody
    • Excision repair cross complementation group 1 antibody
    • Excision repair cross complementing 1 antibody
    • Excision Repair Cross Complementing Rodent Repair Deficiency Complementation Group 1 antibody
    • Excision repair protein antibody
    • RAD 10 antibody
    • RAD10 antibody
    • UV 20 antibody
    • UV20 antibody
    see all

Images

  • All lanes : Anti-ERCC1 antibody (ab22193) at 1/1000 dilution

    Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
    Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug

    Secondary
    Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution

    Predicted band size : 32 kDa

References

ab22193 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab22193.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up