
  • Product name
  • Description
    Rabbit polyclonal to eRF3B/GSPT2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 143-192 (MALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSV I) of Human eRF3B/GSPT2 (NP_060564)

  • Positive control
    • MCF7 cytoplasmic lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab84180 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 69 kDa (predicted molecular weight: 69 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Involved in translation termination in response to the termination codons UAA, UAG and UGA. May play a role as a potent stimulator of the release factor activity of ETF1. Exhibits GTPase activity, which is ribosome- and ETF1-dependent. May play a role in cell cycle progression. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.
  • Tissue specificity
    Highly expressed in IUCC stage II colorectal cancer (CRC).
  • Sequence similarities
    Belongs to the GTP-binding elongation factor family. ERF3 subfamily.
  • Cellular localization
  • Information by UniProt
  • Database links
  • Alternative names
    • eRF3b antibody
    • ERF3B_HUMAN antibody
    • Eukaryotic peptide chain release factor GTP-binding subunit ERF3B antibody
    • Eukaryotic peptide chain release factor subunit 3b antibody
    • G1 to S phase transition 2 antibody
    • G1 to S phase transition protein 2 homolog antibody
    • Gspt2 antibody
    • GST2 antibody
    • peptide chain release factor 3 antibody
    see all

Anti-eRF3B/GSPT2 antibody images

  • Anti-eRF3B/GSPT2 antibody (ab84180) at 1 µg/ml + MCF7 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 69 kDa
    Observed band size : 69 kDa

References for Anti-eRF3B/GSPT2 antibody (ab84180)

ab84180 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84180.
Please use the links above to contact us or submit feedback about this product.


Sign up