Overview

  • Product nameAnti-ERH antibody
    See all ERH primary antibodies
  • Description
    Rabbit polyclonal to ERH
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 50-99 (TYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQA ) of Human ERH (NP_004441.1).

  • Positive control
    • Human fetal brain lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122966 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 12 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-ERH antibody images

  • Anti-ERH antibody (ab122966) at 1 µg/ml + Human fetal brain lysate at 10 µg

    Predicted band size : 12 kDa

References for Anti-ERH antibody (ab122966)

ab122966 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122966.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"