Overview

  • Product name
    Anti-Estrogen Related Receptor gamma antibody
    See all Estrogen Related Receptor gamma primary antibodies
  • Description
    Rabbit polyclonal to Estrogen Related Receptor gamma
  • Tested applications
    Suitable for: ELISA, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human, Zebrafish
    Predicted to work with: Rat, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to Human Estrogen Related Receptor gamma aa 213-262 (internal sequence).
    Sequence:

    RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI

  • Positive control
    • Jurkat cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab49129 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/62500.
WB Use a concentration of 0.5 µg/ml. Detects a band of approximately 51 kDa (predicted molecular weight: 51 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use at an assay dependent concentration.

Target

  • Function
    Orphan receptor that acts as transcription activator in the absence of bound ligand. Binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements.
  • Tissue specificity
    Expressed in the heart, kidney, brain, lung, bone marrow, adrenal gland, trachea, spinal cord and thyroid gland.
  • Sequence similarities
    Belongs to the nuclear hormone receptor family. NR3 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Developmental stage
    Expressed at high levels in fetal brain and also in the fetal kidney, lung and liver.
  • Post-translational
    modifications
    Sumoylation on Lys-40 is enhanced by phosphorylation at Ser-45 and represses transcriptional activity.
    Phosphorylation on Ser-45 enhances sumoylation on Lys-40 thus repressing transcriptional activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp781L1617 antibody
    • ERR 3 antibody
    • ERR G2 antibody
    • ERR gamma 2 antibody
    • ERR gamma-2 antibody
    • ERR3 antibody
    • ERR3_HUMAN antibody
    • ERRG 2 antibody
    • ERRG2 antibody
    • ERRgamma antibody
    • ESRRG antibody
    • Estrogen receptor related protein 3 antibody
    • Estrogen receptor-related protein 3 antibody
    • Estrogen-related receptor gamma antibody
    • FLJ16023 antibody
    • KIAA0832 antibody
    • NR3B3 antibody
    • Nuclear receptor subfamily 3 group B member 3 antibody
    see all

Images

  • Anti-Estrogen Related Receptor gamma antibody (ab49129) at 0.25 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size : 51 kDa
    Observed band size : 51 kDa
    Gel concentration 12%
  • Ab49129, at a concentration of 4-8 µg/ml, positively labelling Estrogen Related Receptor gamma in epithelial cells of bronchiole (indicated by arrows) in paraffin embedded human lung tissue by Immunohistochemistry.
  • All lanes : Anti-Estrogen Related Receptor gamma antibody (ab49129) at 0.5 µg/ml

    Lane 1 : Markers
    Lane 2 : Zebrafish brain homogenate at 20 µg
    Lane 3 : Zebrafish heart homogenate at 20 µg
    Lane 4 : Zebrafish liver homogenate at 20 µg
    Lane 5 : Zebrafish skeletal muscle homogenate at 20 µg
    Lane 6 : Mouse Brain Homogenate at 20 µg

    Secondary
    Goat polyclonal to Rabbit IgG – H&L – Pre-Adsorbed (HRP) at 1/6000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Predicted band size : 51 kDa
    Observed band size : 53 kDa (why is the actual band size different from the predicted?)


    Exposure time : 5 minutes

References

This product has been referenced in:
  • Krzysik-Walker SM  et al. The Biarylpyrazole Compound AM251 Alters Mitochondrial Physiology Via Proteolytic Degradation of ERRa Mol Pharmacol N/A:N/A (2012). WB ; Human . Read more (PubMed: 23066093) »
  • Dwivedi SK  et al. Bile acid receptor agonist GW4064 regulates PPAR? coactivator-1a expression through estrogen receptor-related receptor a. Mol Endocrinol 25:922-32 (2011). Read more (PubMed: 21493670) »

See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab49129.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up