Overview

  • Product name
  • Description
    Rabbit polyclonal to ETNK2
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ETNK2 aa 203-385. NCBI Accession No. NP_060678.2
    Sequence:

    YFTLVKNEINPSLSADVPKVEVLERELAWLKEHLSQLESPVVFCHNDLLC KNIIYDSIKGHVRFIDYEYAGYNYQAFDIGNHFNEFAGVNEVDYCLYPAR ETQLQWLHYYLQAQKGMAVTPREVQRLYVQVNKFALASHFFWALWALIQN QYSTIDFDFLRYAVIRFNQYFKVKPQASALEMP


    Database link: Q9NVF9

  • Positive control
    • Human small intestine tissue; Human fetal liver and kidney lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab211514 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Highly specific for ethanolamine phosphorylation. Does not have choline kinase activity.
  • Tissue specificity
    Expressed in kidney, liver, ovary, testis and prostate.
  • Pathway
    Phospholipid metabolism; phosphatidylethanolamine biosynthesis; phosphatidylethanolamine from ethanolamine: step 1/3.
  • Sequence similarities
    Belongs to the choline/ethanolamine kinase family.
  • Information by UniProt
  • Database links
  • Alternative names
    • 4933417N20Rik antibody
    • AI197444 antibody
    • EC 2.7.1.82 antibody
    • EKI 2 antibody
    • EKI2 antibody
    • EKI2_HUMAN antibody
    • Ethanolamine kinase 2 antibody
    • Ethanolamine kinase like protein antibody
    • Ethanolamine kinase-like protein antibody
    • ETNK 2 antibody
    • ETNK2 antibody
    • FLJ10761 antibody
    • HMFT1716 antibody
    • RP11 74C13.2 antibody
    • Tuc1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human Small Intestine tissue labeling ETNK2 with ab211514 at 10 µg/ml.

References

ab211514 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211514.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up