Overview

  • Product nameAnti-EVA1 antibody
    See all EVA1 primary antibodies
  • Description
    Rabbit polyclonal to EVA1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    synthetic peptide corresponding to a region within N terminal amino acids 35-84 (LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDP F) of Human EVA1 (NP_005788)

  • Positive control
    • OVCAR-3 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab98877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceEpithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. EVA1 is expressed in the thymus and in several epithelial structures early in embryogenesis. It is highly homologous to the myelin protein zero and is poorly soluble in nonionic detergents, strongly suggesting an association to the cytoskeleton. Its capacity to mediate cell adhesion through a homophilic interaction and its selective regulation by T cell maturation might imply the participation of EVA in the earliest phases of thymus organogenesis. The protein bears a characteristic V-type domain and two potential N-glycosylation sites in the extracellular domain; a putative serine phosphorylation site for casein kinase 2 is also present in the cytoplasmic tail. EVA1 expression is elevated in some T-cell leukemias. There are two isoforms.
  • Cellular localizationCell Membrane; Single-pass type I membrane protein, cytoskeleton
  • Database links
  • Alternative names
    • Epithelial V like antigen 1 antibody
    • EVA antibody
    • EVA1 antibody
    • MPZL2 antibody
    • MPZL2 myelin protein zero like 2 antibody
    • Myelin protein zero like 2 antibody
    • Myelin protein zero like protein 2 antibody
    see all

Anti-EVA1 antibody images

  • Anti-EVA1 antibody (ab98877) at 1 µg/ml + OVCAR-3 cell lysate at 10 µg

    Predicted band size : 24 kDa

References for Anti-EVA1 antibody (ab98877)

ab98877 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"