Overview

  • Product nameAnti-EXOC5 antibody
    See all EXOC5 primary antibodies
  • Description
    Rabbit polyclonal to EXOC5
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 107-156 (

    ATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKI

    ) of Human EXOC5 (NP_006535).

  • Positive control
    • A549 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab102541 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 82 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceEXOC5 is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.
  • Cellular localizationCytoplasmic
  • Database links
  • Alternative names
    • AI447711 antibody
    • AI448003 antibody
    • DKFZp666H126 antibody
    • EXOC5 antibody
    • exocyst complex component 5 antibody
    • Exocyst complex component Sec10 antibody
    • Gm76 antibody
    • HSEC10 antibody
    • p71 component of rsec6/8 secretory complex antibody
    • PRO1912 antibody
    • SEC10 antibody
    • SEC10 like 1 antibody
    • SEC10L1 antibody
    • SEC10P antibody
    see all

Anti-EXOC5 antibody images

  • Anti-EXOC5 antibody (ab102541) at 1 µg/ml + A549 cell lysate at 10 µg

    Predicted band size : 82 kDa

References for Anti-EXOC5 antibody (ab102541)

ab102541 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102541.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"