Overview

  • Product name
    Anti-Exonuclease 1 antibody
    See all Exonuclease 1 primary antibodies
  • Description
    Rabbit polyclonal to Exonuclease 1
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Immunogen maps to a region within:

    LSHFSKKDTPLRNKVPGLYKSSSADSLSTTKIKPLGPARASGLSKKPASI QK

    , corresponding to amino acids 725-775 of Human Exonuclease 1 (NP_006018.4).

  • Positive control
    • HeLa and 293T whole cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium Azide
    Constituents: Tris citrate/phosphate, pH 7-8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab95012 was affinity purified using an epitope specific to Exonuclease 1 immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab95012 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 94 kDa.
IP Use at 5-15 µg/mg of lysate.

Target

  • Function
    5'->3' double-stranded DNA exonuclease which may also possess a cryptic 3'->5' double-stranded DNA exonuclease activity. Functions in DNA mismatch repair (MMR) to excise mismatch-containing DNA tracts directed by strand breaks located either 5' or 3' to the mismatch. Also exhibits endonuclease activity against 5'-overhanging flap structures similar to those generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. Required for somatic hypermutation (SHM) and class switch recombination (CSR) of immunoglobulin genes. Essential for male and female meiosis.
  • Tissue specificity
    Highly expressed in bone marrow, testis and thymus. Expressed at lower levels in colon, lymph nodes, ovary, placenta, prostate, small intestine, spleen and stomach.
  • Sequence similarities
    Belongs to the XPG/RAD2 endonuclease family. EXO1 subfamily.
  • Developmental stage
    Highly expressed in fetal liver and at lower levels in fetal brain, heart, kidney, spleen and thymus.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage and in response to agents stalling DNA replication, probably by ATM or ATR. Phosphorylation at Ser-454, Thr-621 and Ser-714 is induced upon DNA-damage caused by treatment with hydroxyurea (HU) but not upon IR treatment. The HU-induced EXO1 triple phosphorylation facilitates destabilisation/degradation of the protein.
  • Cellular localization
    Nucleus. Colocalizes with PCNA to discrete nuclear foci in S-phase.
  • Information by UniProt
  • Database links
  • Alternative names
    • exo1 antibody
    • EXO1_HUMAN antibody
    • ExoI antibody
    • Exonuclease 1 antibody
    • Exonuclease I antibody
    • Exonuclease1 antibody
    • HEX1 antibody
    • hExo I antibody
    • hExo1 antibody
    • hExoI antibody
    • Rad2 nuclease family member homolog of S. cerevisiae exonuclease 1 antibody
    see all

Images

  • All lanes : Anti-Exonuclease 1 antibody (ab95012) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique

    Predicted band size : 94 kDa


    Exposure time : 30 seconds
  • ab95012 at 1 µg/ml detecting Exonuclease 1 in HeLa whole cell lysate by WB following IP.
    Lane 1: ab95012 with 10µg/mg of lysate
    Lane 2: IP with an antibody which recognizes an downstream epitope of Exonuclease 1
    Lane 3: control IgG.
    In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded.
    Detection: Chemiluminescence with an exposure time of 30 seconds

References

This product has been referenced in:
  • Lee KY  et al. MCM8-9 complex promotes resection of double-strand break ends by MRE11-RAD50-NBS1 complex. Nat Commun 6:7744 (2015). WB . Read more (PubMed: 26215093) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab95012.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up