Overview

  • Product nameAnti-EXPH5 antibody
  • Description
    Rabbit polyclonal to EXPH5
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Horse, Cow
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 1907-1956 (QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEP L) of Human EXPH5 (NP_055880).

  • Positive control
    • ACHN cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration. PubMed: 23176819
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 223 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceMay act as Rab effector protein and play a role in vesicle trafficking.
  • Database links
  • Alternative names
    • DKFZp586F1223 antibody
    • DKFZp781H0795 antibody
    • Exophilin 5 antibody
    • Exophilin5 antibody
    • KIAA0624 antibody
    • MGC133291 antibody
    • MGC134967 antibody
    • SLAC2-B antibody
    • SLAC2B antibody
    • slp homolog lacking C2 domains b antibody
    • synaptotagmin-like homologue lacking C2 domains b antibody
    • synaptotagmin-like protein homolog lacking C2 domains b antibody
    see all

Anti-EXPH5 antibody images

  • Anti-EXPH5 antibody (ab99021) at 1 µg/ml + ACHN cell lysate at 10 µg

    Predicted band size : 223 kDa

References for Anti-EXPH5 antibody (ab99021)

This product has been referenced in:
  • Liu L  et al. Mutations in EXPH5 result in autosomal recessive inherited skin fragility. Br J Dermatol 170:196-9 (2014). Human . Read more (PubMed: 24443915) »
  • McGrath JA  et al. Germline Mutation in EXPH5 Implicates the Rab27B Effector Protein Slac2-b in Inherited Skin Fragility. Am J Hum Genet 91:1115-21 (2012). IHC-P ; Human . Read more (PubMed: 23176819) »

See all 2 Publications for this product

Product Wall

There are currently no Abreviews or Questions for ab99021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"