
  • Product name
  • Description
    Rabbit polyclonal to EY Cadherin
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 143-192 (NDNPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDPSYGNSAKLVYTV L) of Human EY Cadherin (NP_071923).

  • Positive control
    • Human placenta lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab81343 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 97 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/62500.


  • Relevance
    Cadherins are calcium dependent cell adhesion proteins which mediate cell-to-cell interaction. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. EY cadherin (Cadherin-24) mediates strong cell-cell adhesion.
  • Cellular localization
    Cell membrane; Single-pass type I membrane protein.
  • Database links
  • Alternative names
    • Cadherin 24 antibody
    • Cadherin like 24 antibody
    • cadherin-like 24 antibody
    • Cadherin24 antibody
    • CDH 11L antibody
    • CDH 24 antibody
    • CDH11L antibody
    • CDH24 antibody
    • FLJ 25193 antibody
    • FLJ25193 antibody
    • MGC 131880 antibody
    • MGC131880 antibody
    see all

Anti-EY Cadherin antibody images

  • Anti-EY Cadherin antibody (ab81343) at 1 µg/ml + Human placenta lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 97 kDa
    Observed band size : 90 kDa (why is the actual band size different from the predicted?)

References for Anti-EY Cadherin antibody (ab81343)

ab81343 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81343.
Please use the links above to contact us or submit feedback about this product.


Sign up