Overview

  • Product name
  • Description
    Mouse polyclonal to EYA1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human EYA1 aa 100-170.
    Sequence:

    TPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTE GGLSQSQSPGQTGFLSYGTSF


    Database link: Q99502

  • Positive control
    • EYA1 recombinant protein; Jurkat cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab194448 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 65 kDa.

Target

  • Function
    Tyrosine phosphatase that specifically dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph). 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Promotes efficient DNA repair by dephosphorylating H2AX, promoting the recruitment of DNA repair complexes containing MDC1. Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis. Seems to coactivate SIX2, SIX4 and SIX5. May be required for normal development of branchial arches, ear and kidney.
  • Tissue specificity
    In the embryo, highly expressed in kidney with lower levels in brain. Weakly expressed in lung. In the adult, highly expressed in heart and skeletal muscle. Weakly expressed in brain and liver. No expression in eye or kidney.
  • Involvement in disease
    Defects in EYA1 are the cause of branchiootorenal syndrome type 1 (BOR1) [MIM:113650]; also known as Melnick-Fraser syndrome. BOR is an autosomal dominant disorder manifested by various combinations of preauricular pits, branchial fistulae or cysts, lacrimal duct stenosis, hearing loss, structural defects of the outer, middle, or inner ear, and renal dysplasia. Associated defects include asthenic habitus, long narrow facies, constricted palate, deep overbite, and myopia. Hearing loss may be due to mondini type cochlear defect and stapes fixation. Penetrance of BOR syndrome is high, although expressivity can be extremely variable.
    Defects in EYA1 are the cause of otofaciocervical syndrome (OFCS) [MIM:166780]. The syndrome is characterized by trophic alterations of the facies and shoulder girdle in addition to the malformations seen in BOR.
    Defects in EYA1 are the cause of branchiootic syndrome type 1 (BOS1) [MIM:602588]; also known as BO syndrome type 1 or branchiootic dysplasia. Individuals with BOS1 are affected by the same branchial and otic anomalies as those seen in individuals with BOR1, but lack renal anomalies.
  • Sequence similarities
    Belongs to the HAD-like hydrolase superfamily. EYA family.
  • Developmental stage
    Detected in cytoplasm of somite cells at the beginning of fourth week of development. Detected in cytoplasm of limb bud cell between the sixth and eighth week of development.
  • Post-translational
    modifications
    Sumoylated by SUMO1.
  • Cellular localization
    Cytoplasm. Nucleus. Localizes at sites of DNA damage at double-strand breaks.
  • Information by UniProt
  • Database links
  • Alternative names
    • BOP antibody
    • BOR antibody
    • BOS1 antibody
    • EYA transcriptional coactivator and phosphatase 1 antibody
    • Eya1 antibody
    • EYA1_HUMAN antibody
    • Eyes absent 1 antibody
    • Eyes absent 1 homolog antibody
    • Eyes absent homolog 1 (Drosophila) antibody
    • Eyes absent homolog 1 antibody
    • Eyes absent homolog1 antibody
    • MGC141875 antibody
    • OFC1 antibody
    see all

Images

  • Anti-EYA1 antibody (ab194448) at 1/1000 dilution + EYA1 recombinant protein (immunizing peptide) at 0.2 µg

    Predicted band size: 65 kDa
    Observed band size: 34 kDa (why is the actual band size different from the predicted?)



    The observed band size may not correspond to the predicted protein molecular weight as the immunogen (recombinant fragment) was used for the test lane. 

  • Anti-EYA1 antibody (ab194448) at 1/500 dilution + Jurkat cell lysate at 50 µg

    Predicted band size: 65 kDa

References

ab194448 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Xenopus laevis Tissue lysate - whole (Whole stage 37 embryo lysate)
Gel Running Conditions
Reduced Denaturing (12% gel)
Loading amount
25 µg
Specification
Whole stage 37 embryo lysate
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C
Username

Abcam user community

Verified customer

Submitted Jul 26 2016

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up