Overview

  • Product nameAnti-Factor XIII antibody
    See all Factor XIII primary antibodies
  • Description
    Rabbit polyclonal to Factor XIII
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 216-265 (LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPES P) of Human Factor XIII (NP_001985)

  • Positive control
    • HeLa cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab83895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 76 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceFactor XIII is activated by thrombin and calcium ions to a transglutaminase that catalyzes the formation of gamma-glutamyl- epsilon-lysine cross-links between fibrin chains, thus stabilizing the fibrin clot. It also cross-links alpha-2-plasmin inhibitor, or fibronectin, to the alpha chains of fibrin. Factor XIII belongs to the transglutaminase family.
  • Cellular localizationCytoplasmic
  • Database links
  • Alternative names
    • Coagulation factor XIII, A2 polypeptide antibody
    • Coagulation factor XIII, B polypeptide antibody
    • F13A2 antibody
    • F13B antibody
    • FXIIIB antibody
    see all

Anti-Factor XIII antibody images

  • Anti-Factor XIII antibody (ab83895) at 1 µg/ml + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 76 kDa
    Observed band size : 80 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 62 kDa. We are unsure as to the identity of these extra bands.

References for Anti-Factor XIII antibody (ab83895)

This product has been referenced in:
  • Johnson KB  et al. Vena cava and aortic smooth muscle cells express transglutaminases 1 and 4 in addition to transglutaminase 2. Am J Physiol Heart Circ Physiol 302:H1355-66 (2012). WB, IHC-P, ICC/IF ; Rat . Read more (PubMed: 22307675) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab83895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"