Overview

  • Product name
  • Description
    Mouse polyclonal to FAIM3
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human FAIM3 aa 1-390.
    Sequence:

    MDFWLWPLYFLPVSGALRILPEVKVEGELGGSVTIKCPLPEMHVRIYLCR EMAGSGTCGTVVSTTNFIKAEYKGRVTLKQYPRKNLFLVEVTQLTESDSG VYACGAGMNTDRGKTQKVTLNVHSEYEPSWEEQPMPETPKWFHLPYLFQM PAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDK PRTFLPSTTASKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGREGQ GFHILIPTILGLFLLALLGLVVKRAVERRKALSRRARRLAVRMRALESSQ RPRGSPRPRSQNNIYSACPRRARGADAAGTGEAPVPGPGAPLPPAPLQVS ESPWLHAPSLKTSCEYVSLYHQPAAMMEDSDSDDYINVPA


    Database link: NP_005440.1

  • Positive control
    • Human tonsil tissue; FAIM3 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab168968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa.
IHC-P Use a concentration of 3 µg/ml.

Target

  • Function
    May play a role in the immune system processes. Protects cells from FAS-, TNF alpha- and FADD-induced apoptosis without increasing expression of the inhibitors of apoptosis BCL2 and BCLXL. Seems to activate an inhibitory pathway that prevents CASP8 activation following FAS stimulation, rather than blocking apoptotic signals downstream. May inhibit FAS-induced apoptosis by preventing CASP8 processing through CFLAR up-regulation.
  • Tissue specificity
    Expressed in lymph nodes, peripheral blood leukocytes, lung, thymus and kidneys. Very weak expression detected in spleen, liver, heart, and salivary gland. Expressed in lymphoid cell lines such as Jurkat cells, CemT4 cells, MolT-4 cells, HB11.19 cells, and Reh cells. No expression detected in nonhematopoietic cell lines, including HepG2 cells, 293 cells and Hela cells.
  • Sequence similarities
    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Domain
    The Ig-like domain is required for the anti-apoptotic ability.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Faim3 antibody
    • FAIM3_HUMAN antibody
    • Fas apoptotic inhibitory molecule 3 antibody
    • Fc fragment of IgM receptor antibody
    • Fc mu receptor antibody
    • FCMR antibody
    • IgM Fc receptor antibody
    • Immunoglobulin mu Fc receptor antibody
    • Regulator of Fas induced apoptosis antibody
    • Regulator of Fas-induced apoptosis Toso antibody
    • TOSO antibody
    see all

Images

  • All lanes : Anti-FAIM3 antibody (ab168968) at 1 µg/ml

    Lane 1 : FAIM3 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Predicted band size: 43 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human tonsil tissue labeling FAIM3 with ab168968 at 3 μg/ml.

References

ab168968 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168968.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up