
  • Product nameAnti-FAM108B1 antibody
    See all FAM108B1 primary antibodies
  • Description
    Rabbit polyclonal to FAM108B1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 107-156 (SSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTR Y) of human FAM108B1 (NP_057098).

  • Positive control
    • human fetal brain lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab85505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa.Can be blocked with FAM108B1 peptide (ab221416). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-FAM108B1 antibody images

  • Anti-FAM108B1 antibody (ab85505) at 1 µg/ml + Fetal brain lysate at 10 µg

    HRP-conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 32 kDa
    Observed band size : 32 kDa

References for Anti-FAM108B1 antibody (ab85505)

ab85505 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85505.
Please use the links above to contact us or submit feedback about this product.