
  • Product nameAnti-FAM114A2 antibody
    See all FAM114A2 primary antibodies
  • Description
    Rabbit polyclonal to FAM114A2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 432-481 (GVREKADVLNPVITAVFLEASNSASYIQDAFQLLLPVLQISLIESKTES S) of Mouse FAM114A2 (NP_080618).

  • Positive control
    • Mouse pancreas lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products


Our Abpromise guarantee covers the use of ab122965 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 54 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-FAM114A2 antibody images

  • Anti-FAM114A2 antibody (ab122965) at 1 µg/ml + Mouse pancreas lysate at 10 µg

    Predicted band size : 54 kDa

References for Anti-FAM114A2 antibody (ab122965)

ab122965 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122965.
Please use the links above to contact us or submit feedback about this product.