
  • Product name
  • Description
    Rabbit polyclonal to FAM119A
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 71-120 (LGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVV K) of human FAM119A (NP_660323).

  • Positive control
    • Human Fetal Liver lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab84523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-FAM119A antibody images

  • Anti-FAM119A antibody (ab84523) at 1 µg/ml + Human Fetal Liver lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1: 50,000

    Predicted band size : 25 kDa
    Observed band size : 25 kDa
    Additional bands at : 44 kDa. We are unsure as to the identity of these extra bands.

References for Anti-FAM119A antibody (ab84523)

ab84523 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84523.
Please use the links above to contact us or submit feedback about this product.


Sign up