Overview

  • Product name
  • Description
    Rabbit polyclonal to FAM13B1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human FAM13B1 aa 6-95.
    Sequence:

    SPSLSNCNSVLANKIFGIPLDELQQGGHPDNEVPFIVRHVVDYIEEHGGL EQQGLFQVNGNAETVEWLRQRYDSGEEVDLVKEADVPSAI


    Database link: Q9NYF5

  • Positive control
    • U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

Images

  • Immunofluorescent analysis of U-2 OS cells (PFA-fixed/Triton X-100 permeabilized) labeling FAM13B1 with ab220264 at 4μg/ml (green).

References

ab220264 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220264.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up