Overview

  • Product nameAnti-FAM161B antibody
  • Description
    Rabbit polyclonal to FAM161B
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 504 - 553 (

    MDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQV

    ) of Human FAM161B (NP_689658)

  • Positive control
    • THP1 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab90125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 74 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceBelongs to the FAM161 family. The specific function of FAM161B remains unknown.
  • Database links
  • Alternative names
    • 9330169D17 antibody
    • 9830169C18Rik antibody
    • c14_5547 antibody
    • C14orf44 antibody
    • Chromosome 14 open reading frame 44 antibody
    • Family with sequence similarity 161, member B antibody
    • FLJ31697 antibody
    • Hypothetical protein LOC145483 antibody
    • Protein FAM161B antibody
    see all

Anti-FAM161B antibody images

  • Anti-FAM161B antibody (ab90125) at 1 µg/ml + THP1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 74 kDa

References for Anti-FAM161B antibody (ab90125)

ab90125 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"