Overview

  • Product nameAnti-FAM171A1 antibody
  • Description
    Rabbit polyclonal to FAM171A1
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Guinea pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 468-517 (

    ARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQE

    ) of Human FAM171A1 (NP_001010924)

  • Positive control
    • 293 T cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab83777 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 98 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/62500.

Target

  • RelevanceThe exact function of FAM171A1, which is also known as C10orf38, remains unknown.
  • Cellular localizationMembrane; Single-pass type I membrane protein (Potential)
  • Database links
  • Alternative names
    • Astroprincin antibody
    • C10orf38 antibody
    • chromosome 10 open reading frame 38 antibody
    • family with sequence similarity 171, member A1 antibody
    • FLJ12884 antibody
    • hypothetical protein LOC221061 antibody
    • MGC130014 antibody
    • MGC130015 antibody
    • OTTHUMP00000019205 antibody
    see all

Anti-FAM171A1 antibody images

  • Anti-FAM171A1 antibody (ab83777) at 1 µg/ml (in 5% skim milk / PBS buffer) + 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 98 kDa
    Observed band size : >90 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 50 kDa,75 kDa. We are unsure as to the identity of these extra bands.

References for Anti-FAM171A1 antibody (ab83777)

ab83777 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83777.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"