Overview

  • Product nameAnti-FAM173B antibody
    See all FAM173B primary antibodies
  • Description
    Rabbit polyclonal to FAM173B
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 2-51 (

    EGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAV

    ) of human FAM173B (NP_954584).

  • Positive control
    • Fetal lung lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • Purification notesab81219 is purified by peptide affinity chromatography method.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81219 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:312500.

Target

  • RelevanceFAM173B belongs to the FAM173 family. The function of this protein is unknown.
  • Cellular localizationMembrane; Single pass membrane protein
  • Database links
  • Alternative names
    • FAM173 B antibody
    • Family with sequence similarity 173, member B antibody
    • FLJ20667 antibody
    • Hypothetical protein LOC134145 antibody
    • LOC134145 antibody
    see all

Anti-FAM173B antibody images

  • Anti-FAM173B antibody (ab81219) at 1 µg/ml (in 5% skim milk / PBS buffer) + fetal lung lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 26 kDa
    Observed band size : 26 kDa

References for Anti-FAM173B antibody (ab81219)

ab81219 has not yet been referenced specifically in any publications.

Product Wall

Thank you very much for your interest our products.
We have two antibodies against FAM173B. The immunogen of ab70737 shows a 81% homology with mouse. This is boarder line, but ab70737 could cross-react with mouse. To our knowledge, ab70737 has not...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"