Overview

  • Product name
  • Description
    Rabbit polyclonal to FAM32A
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human FAM32A aa 55-112.
    Sequence:

    RLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHY DIPKVSWTK


    Database link: Q9Y421

  • Positive control
    • A-431 cells; RT-4 and U-251MG sp cell lysates; Human small intestine tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185298 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 13 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human small intestine tissue labeling FAM32A with ab185298 at 1/200 dilution.

  • All lanes : Anti-FAM32A antibody (ab185298) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251MG sp cell lysate


    Predicted band size : 13 kDa
  • Immunofluorescent analysis of paraformaldehyde-fixed, Triton X-100-permeabilized A431 cells labeling FAM32A with ab185298 at 4 µg/ml.

References

ab185298 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185298.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up