Overview

  • Product name
  • Description
    Rabbit polyclonal to FAM58A
  • Tested applications
    Suitable for: ELISA, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein (proprietary-tag) corresponding to Human FAM58A aa 1-248.
    Sequence:

    MEAPEGGGGGPAARGPEGQPAPEARVHFRVARFIMEAGVKLGMRSIPIAT ACTIYHKFFCETNLDAYDPYLIAMSSIYLAGKVEEQHLRTRDIINVSNRY FNPSGEPLELDSRFWELRDSIVQCELLMLRVLRFQVSFQHPHKYLLHYLV SLQNWLNRHSWQRTPVAVTAWALLRDSYHGALCLRFQAQHIAVAVLYLAL QVYGVEVPAEVEAEKPWWQVFNDDLTKPIIDNIVSDLIQIYTMDTEIP


    Database link: Q8N1B3

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 1.21% Tris, 0.75% Glycine, 2% Sucrose
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab181779 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
IHC-P 1/100 - 1/1000.
WB 1/200 - 1/2000. Predicted molecular weight: 28 kDa.

Target

  • Function
    May have a role in cell proliferation.
  • Involvement in disease
    Toe syndactyly, telecanthus, and anogenital and renal malformations
  • Sequence similarities
    Belongs to the cyclin family. Cyclin-like FAM58 subfamily.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cyclin-M antibody
    • Cyclin-related protein FAM58A antibody
    • FA58A_HUMAN antibody
    • Fam58a antibody
    • Family with sequence similarity 58 member A antibody
    • STAR antibody
    see all

References

ab181779 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181779.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up