Overview

  • Product name
  • Description
    Rabbit polyclonal to FAM62A
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human FAM62A aa 580-665.
    Sequence:

    SSGPNSRLYMKLVMRILYLDSSEICFPTVPGCPGAWDVDSENPQRGSSVD APPRPCHTTPDSQFGTEHVLRIHVLEAQDLIAKDRF


    Database link: Q9BSJ8

  • Positive control
    • ICC/IF: U-2 OS cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221873 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    May play a role as calcium-regulated intrinsic membrane protein.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the extended synaptotagmin family.
    Contains 5 C2 domains.
  • Cellular localization
    Membrane. Localizes to intracellular membranes.
  • Information by UniProt
  • Database links
  • Alternative names
    • E Syt1 antibody
    • E-Syt1 antibody
    • Esyt1 antibody
    • ESYT1_HUMAN antibody
    • Extended synaptotagmin 1 antibody
    • Extended synaptotagmin like protein 1 antibody
    • Extended synaptotagmin-1 antibody
    • Family with sequence similarity 62 (C2 domain containing) member A antibody
    • Family with sequence similarity 62 member A antibody
    • KIAA0747 antibody
    • MBC2 antibody
    • Membrane bound C2 domain containing protein antibody
    • Membrane-bound C2 domain-containing protein antibody
    • Protein FAM62A antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for FAM62A (green) using ab221873 at 4 ug/ml in ICC/IF.

References

ab221873 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221873.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up