Overview

  • Product nameAnti-FAM70A antibody
    See all FAM70A primary antibodies
  • Description
    Rabbit polyclonal to FAM70A
  • Tested applicationsSuitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 107-156 (

    IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR

    ) of Human FAM70A (NP_060408).

  • Positive control
    • Jurkat cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab82866 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/1562500.

WB Use a concentration of 1 µg/ml. Detects a band of approximately 38 kDa (predicted molecular weight: 38 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-FAM70A antibody images

  • Anti-FAM70A antibody (ab82866) at 1 µg/ml (5% skim milk / PBS buffer) + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 38 kDa
    Observed band size : 38 kDa
    Additional bands at : 27 kDa,29 kDa,55 kDa. We are unsure as to the identity of these extra bands.

References for Anti-FAM70A antibody (ab82866)

ab82866 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82866.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"