Overview

  • Product nameAnti-FAM71D antibody
  • Description
    Rabbit polyclonal to FAM71D
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Guinea pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 288-337 (

    TVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISNI

    ) of Human FAM71D (NP_775797)

  • Positive control
    • Fetal kidney lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab90262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceFAM71D belongs to the FAM71 family. The specific function of the protein remains unknown.
  • Database links
  • Alternative names
    • 4921509E07Rik antibody
    • 4930516C23Rik antibody
    • C14orf54 antibody
    • Chromosome 14 open reading frame 54 antibody
    • Family with sequence similarity 71, member D antibody
    • FLJ36130 antibody
    • GARI-L2 antibody
    • Golgi-associated Rab2B interactor-like 2 antibody
    • Hypothetical protein LOC161142 antibody
    • Protein FAM71D antibody
    • RIKEN cDNA 4921509E07, isoform CRA_b antibody
    see all

Anti-FAM71D antibody images

  • Anti-FAM71D antibody (ab90262) at 1 µg/ml + Human fetal kidney lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 47 kDa

References for Anti-FAM71D antibody (ab90262)

ab90262 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"