Overview

  • Product name
    Anti-FAM71D antibody
  • Description
    Rabbit polyclonal to FAM71D
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Guinea pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 288-337 (

    TVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISNI

    ) of Human FAM71D (NP_775797)

  • Positive control
    • Fetal kidney lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab90262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    FAM71D belongs to the FAM71 family. The specific function of the protein remains unknown.
  • Database links
  • Alternative names
    • 4921509E07Rik antibody
    • 4930516C23Rik antibody
    • C14orf54 antibody
    • Chromosome 14 open reading frame 54 antibody
    • Family with sequence similarity 71, member D antibody
    • FLJ36130 antibody
    • GARI-L2 antibody
    • Golgi-associated Rab2B interactor-like 2 antibody
    • Hypothetical protein LOC161142 antibody
    • Protein FAM71D antibody
    • RIKEN cDNA 4921509E07, isoform CRA_b antibody
    see all

Images

  • Anti-FAM71D antibody (ab90262) at 1 µg/ml + Human fetal kidney lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 47 kDa

References

ab90262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab90262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up