Overview

  • Product nameAnti-FAM76A antibody
    See all FAM76A primary antibodies
  • Description
    Rabbit polyclonal to FAM76A
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region from internal sequence amino acids 108-157 (

    CAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEK

    ) of Human FAM76A (NP_689873).

  • Positive control
    • Human fetal kidney lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab90042 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceThe specific function of FAM76A is not yet known.
  • Database links
  • Alternative names
    • Family with sequence similarity 76, member A antibody
    • FLJ41946 antibody
    • Hypothetical protein LOC230789 antibody
    • MGC11672 antibody
    • MGC34648 antibody
    • OTTMUSP00000010729 antibody
    • RGD1305162 antibody
    • RP23-464L12.5 antibody
    • RP3-426I6.1 antibody
    see all

Anti-FAM76A antibody images

  • Anti-FAM76A antibody (ab90042) at 1 µg/ml (5% skim milk / PBS buffer) + Human fetal kidney lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 35 kDa

References for Anti-FAM76A antibody (ab90042)

ab90042 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90042.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"