
  • Product nameAnti-FAM78A antibody
    See all FAM78A primary antibodies
  • Description
    Rabbit polyclonal to FAM78A
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 211-260 (WRMQLSIEVNPNRPLGQRARLREPIAQDQPKILSKNEPIPPSALVKPNA N) of Human FAM78A (NM_033387).

  • Positive control
    • Transfected 293T lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab108175 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-FAM78A antibody images

  • Anti-FAM78A antibody (ab108175) at 0.5 µg/ml + Transfected 293T lysate at 10 µg

    Predicted band size : 32 kDa

References for Anti-FAM78A antibody (ab108175)

ab108175 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108175.
Please use the links above to contact us or submit feedback about this product.