Overview

  • Product name
  • Description
    Rabbit polyclonal to FAT
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Dog
  • Immunogen

    Synthetic peptide within Human FAT aa 4450-4500. The exact sequence is proprietary. NP_005236.2
    Sequence:

    PLPPEFSNQFESIHPPRDMPAAGSLGSSSRNRQRFNLNQYLPNFYPLDMS E


    Database link: Q14517

  • Positive control
    • HeLa, 293T, Jurkat, NIH 3T3 and TCMK-1 whole cell lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab190242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 506 kDa.

Target

  • Function
    Plays an essential role for cellular polarization, directed cell migration and modulating cell-cell contact.
  • Tissue specificity
    Expressed in many epithelial and some endothelial and smooth muscle cells.
  • Sequence similarities
    Contains 33 cadherin domains.
    Contains 5 EGF-like domains.
    Contains 1 laminin G-like domain.
  • Domain
    A PTB-like motif (DNXYH sequence) is required for the targeting to the leading edge. This motif represents a minimal protein-protein interaction core motif that is not regulated by tyrosine phosphorylation.
  • Post-translational
    modifications
    Undergoes proteolytic cleavage. The extracellular domain is cleaved off and the cytoplasmic domain (about 400 AA) shuttles to the nucleus.
  • Cellular localization
    Cell membrane. Nucleus. Cytoplasm > perinuclear region.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cadherin family member 7 antibody
    • Cadherin family member 7 precursor antibody
    • Cadherin ME5 antibody
    • Cadherin related tumor suppressor antibody
    • Cadherin related tumor suppressor homolog antibody
    • Cadherin related tumor suppressor homolog precursor antibody
    • Cadherin related tumor suppressor homolog precursor (FAT protein homolog) antibody
    • Cadherin-related tumor suppressor homolog antibody
    • CDHF 7 antibody
    • CDHF7 antibody
    • FAT 1 antibody
    • FAT tumor suppressor 1 antibody
    • FAT tumor suppressor homolog 1 antibody
    • FAT1 antibody
    • FAT1_HUMAN antibody
    • hFat 1 antibody
    • hFAT antibody
    • hFat1 antibody
    • Homolog of Drosophila FAT protein antibody
    • Homolog of Drosophila FAT protein precursor antibody
    • Homolog of Drosophila tumor suppressor FAT precursor antibody
    • ME 5 antibody
    • ME5 antibody
    • nuclear form antibody
    • Protein fat homolog antibody
    • Protocadherin Fat 1 antibody
    see all

Images

  • All lanes : Anti-FAT antibody (ab190242) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH 3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique

    Predicted band size : 506 kDa


    Exposure time : 3 minutes

References

ab190242 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up