Overview

  • Product name
  • Description
    Rabbit polyclonal to FBP1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rabbit, Pig
  • Immunogen

    Synthetic peptide corresponding to Human FBP1 aa 125-156 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH). NP_000498.2.
    Sequence:

    SNIDCLVSVGTIFGIYRKKSTDEPSEKDALQP


    Database link: P09467

  • Positive control
    • Human Kidney tissue; MCF7 and Mouse kidney lysates; FBP1 transfected 293 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab191172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 37 kDa.
IHC-P 1/75.

Target

  • Pathway
    Carbohydrate biosynthesis; gluconeogenesis.
  • Involvement in disease
    Defects in FBP1 are the cause of fructose-1,6-bisphosphatase deficiency (FBPD) [MIM:229700]. FBPD is inherited as an autosomal recessive disorder mainly in the liver and causes life-threatening episodes of hypoglycemia and metabolic acidosis (lactacidemia) in newborn infants or young children.
  • Sequence similarities
    Belongs to the FBPase class 1 family.
  • Information by UniProt
  • Database links
  • Alternative names
    • 6-bisphosphatase 1 antibody
    • 6-bisphosphate 1-phosphohydrolase 1 antibody
    • D fructose 1 6 bisphosphate 1 phosphohydrolase 1 antibody
    • D-fructose-1 antibody
    • EC 3.1.3.11 antibody
    • F16P1_HUMAN antibody
    • FBP antibody
    • FBP 1 antibody
    • FBP1 antibody
    • FBPase 1 antibody
    • Fructose 1 6 bisphosphatase 1 antibody
    • Fructose bisphosphatase 1 antibody
    • Fructose-1 antibody
    • Growth inhibiting protein 17 antibody
    • Liver fructose bisphosphatase antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human kidney tissue labeling FBP1 with ab191172 at 1/75 dilution.

  • All lanes : Anti-FBP1 antibody (ab191172) at 1/1000 dilution

    Lane 1 : 293 lysate, untransfected
    Lane 2 : 293 cell lysate, transiently transfected with the FBP1 gene.

    Lysates/proteins at 2 µg per lane.

    Predicted band size: 37 kDa

  • Anti-FBP1 antibody (ab191172) at 1/1000 dilution + Mouse kidney lysate at 35 µg

    Predicted band size: 37 kDa

  • Anti-FBP1 antibody (ab191172) at 1/1000 dilution + MCF7 cell lysate at 35 µg

    Predicted band size: 37 kDa

References

ab191172 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191172.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up