Overview

  • Product name
  • Description
    Rabbit polyclonal to FBXL16
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal aa 432-481 (CPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE) of Human FBXL16 (NP_699181).

  • Positive control
    • HeLa cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab87778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
  • Sequence similarities
    Contains 1 F-box domain.
    Contains 7 LRR (leucine-rich) repeats.
  • Information by UniProt
  • Database links
  • Alternative names
    • BC042620 antibody
    • C16orf22 antibody
    • c380A1.1 (novel protein) antibody
    • c380A1.1 antibody
    • Chromosome 16 open reading frame 22 antibody
    • F box and leucine rich repeat protein 16 antibody
    • F box/LRR repeat protein 16 antibody
    • F-box and leucine-rich repeat protein 16 antibody
    • F-box/LRR-repeat protein 16 antibody
    • Fbl16 antibody
    • FBXL 16 antibody
    • Fbxl16 antibody
    • Fbxl16 F-box and leucine-rich repeat protein 16 antibody
    • FLJ33735 antibody
    • FXL16_HUMAN antibody
    • MGC33974 antibody
    • OTTHUMP00000115487 antibody
    • Scirr1 antibody
    • Spinal cord injury and regeneration-related protein 1 antibody
    see all

Images

  • Anti-FBXL16 antibody (ab87778) at 1 µg/ml + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 52 kDa
    Observed band size : 52 kDa
    Additional bands at : >90 kDa. We are unsure as to the identity of these extra bands.

References

ab87778 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab87778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up