Overview

  • Product nameAnti-FBXL16 antibody
    See all FBXL16 primary antibodies
  • Description
    Rabbit polyclonal to FBXL16
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal aa 432-481 (CPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE) of Human FBXL16 (NP_699181).

  • Positive control
    • HeLa cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab87778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionSubstrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
  • Sequence similaritiesContains 1 F-box domain.
    Contains 7 LRR (leucine-rich) repeats.
  • Information by UniProt
  • Database links
  • Alternative names
    • BC042620 antibody
    • C16orf22 antibody
    • c380A1.1 (novel protein) antibody
    • c380A1.1 antibody
    • Chromosome 16 open reading frame 22 antibody
    • F box and leucine rich repeat protein 16 antibody
    • F box/LRR repeat protein 16 antibody
    • F-box and leucine-rich repeat protein 16 antibody
    • F-box/LRR-repeat protein 16 antibody
    • Fbl16 antibody
    • FBXL 16 antibody
    • Fbxl16 antibody
    • Fbxl16 F-box and leucine-rich repeat protein 16 antibody
    • FLJ33735 antibody
    • FXL16_HUMAN antibody
    • MGC33974 antibody
    • OTTHUMP00000115487 antibody
    • Scirr1 antibody
    • Spinal cord injury and regeneration-related protein 1 antibody
    see all

Anti-FBXL16 antibody images

  • Anti-FBXL16 antibody (ab87778) at 1 µg/ml + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 52 kDa
    Observed band size : 52 kDa
    Additional bands at : >90 kDa. We are unsure as to the identity of these extra bands.

References for Anti-FBXL16 antibody (ab87778)

ab87778 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"