Overview

  • Product nameAnti-FBXO33 antibody
    See all FBXO33 primary antibodies
  • Description
    Rabbit polyclonal to FBXO33
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region from internal sequence amino acids 432-481 (

    IDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARLR

    ) of Human FBXO33 (NP_976046).

  • Positive control
    • Human fetal liver lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 63 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-FBXO33 antibody images

  • Anti-FBXO33 antibody (ab90046) at 1 µg/ml (5% skim milk / PBS buffer) + Human fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 63 kDa

References for Anti-FBXO33 antibody (ab90046)

ab90046 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"