Overview

  • Product nameAnti-FBXO36 antibody
    See all FBXO36 primary antibodies
  • Description
    Rabbit polyclonal to FBXO36
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 37-86 (

    WKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILDYVINLC

    ) of Human FBXO36 (NP_777559).

  • Positive control
    • Human fetal liver lysate.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab81317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 22 kDa.Can be blocked with FBXO36 peptide (ab128001). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/312500.

Target

Anti-FBXO36 antibody images

  • Anti-FBXO36 antibody (ab81317) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 22 kDa
    Observed band size : 27 kDa (why is the actual band size different from the predicted?)

References for Anti-FBXO36 antibody (ab81317)

ab81317 has not yet been referenced specifically in any publications.

Product Wall

Merci de nous avoir contactés et désolé pour ledélai de ma réponse.

Le peptide utilisé pour produire l'anticorps anti-FBXO36 ab81317est maintenant disponible à la vente. La référe...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"