Overview

  • Product name
    Anti-FBXO44 antibody
  • Description
    Rabbit polyclonal to FBXO44
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human FBXO44 aa 86-190. BC007832.
    Sequence:

    CAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVKKYFVTSYYTCLK SQVVDLKAEGYWEELMDTTRPDIEVKDWFAARPDCGSKYQLCVQLLSSAH APLGT


    Database link: Q9H4M3

  • Positive control
    • Human fetal heart lysate and Human fetal brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab196276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/500 - 1/1000. Predicted molecular weight: 30 kDa.

Target

  • Function
    Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
  • Tissue specificity
    Abundantly expressed in brain and kidney. Expressed at lower levels in heart, spleen and liver.
  • Sequence similarities
    Contains 1 F-box domain.
    Contains 1 FBA (F-box associated) domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • 5730411K09 antibody
    • AV001623 antibody
    • DKFZp781J0852 antibody
    • F box gene 3 antibody
    • F box only protein 44 antibody
    • F box only protein 6a antibody
    • F box protein 44 antibody
    • F box protein FBX30 antibody
    • F box/G domain protein 3 antibody
    • F-box only protein 44 antibody
    • F-box protein FBX30 antibody
    • F-box/G-domain protein 3 antibody
    • FBG3 antibody
    • FBX30 antibody
    • FBX44 antibody
    • FBX44_HUMAN antibody
    • FBX6A antibody
    • Fbxo44 antibody
    • Fbxo6a antibody
    • MGC14140 antibody
    • RGD1562463 antibody
    see all

Images

  • Anti-FBXO44 antibody (ab196276) at 1/500 dilution + Human fetal heart lysate

    Predicted band size : 30 kDa
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal brain tissue labeling FBXO44 with ab196276 at 1/100 dilution.

References

ab196276 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up