Overview

  • Product name
  • Description
    Rabbit polyclonal to FBXO7
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FBXO7 aa 159-235.
    Sequence:

    EGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLML ESGYIPQGTEAKALSMPEKWKLSGVYK


    Database link: Q9Y3I1

  • Positive control
    • IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224146 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes BIRC2 and DLGAP5.
  • Pathway
    Protein modification; protein ubiquitination.
  • Involvement in disease
    Defects in FBXO7 are the cause of Parkinson disease type 15 (PARK15) [MIM:260300]; also known as parkinsonian-pyramidal syndrome. A neurodegenerative disorder characterized by parkinsonian and pyramidal signs. Clinical manifestations include tremor, bradykinesia, rigidity, postural instability, spasticity, mainly in the lower limbs, and hyperreflexia.
  • Sequence similarities
    Contains 1 F-box domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • F box only protein 7 antibody
    • F box protein 7 antibody
    • F-box only protein 7 antibody
    • FBX antibody
    • FBX07 antibody
    • FBX7 antibody
    • FBX7_HUMAN antibody
    • Fbxo7 antibody
    • PARK15 antibody
    • PKPS antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for FBXO7 using ab224146 at 1/500 dilution in immunohistochemical analysis.

References

ab224146 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224146.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up