Anti-FCGRT antibody - Extracellular domain (ab193148)

Overview

  • Product name
    Anti-FCGRT antibody - Extracellular domain
    See all FCGRT primary antibodies
  • Description
    Rabbit polyclonal to FCGRT - Extracellular domain
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ICC/IF, ELISA, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human FCGRT aa 24-297 (extracellular).
    Sequence:

    AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGA WVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGP DNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANK ELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSA FSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHY CCIVQHAGLAQPLRVELESPAKSS


    Database link: P55899

  • Positive control
    • WB: HepG2 and A549 whole cell lysates, mouse liver, kidney and spleen tissue lysates. IHC-P: Human placenta and human pancreatic cancer tissues. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab193148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Detects a band of approximately 40 kDa (predicted molecular weight: 40 kDa).
ICC/IF 1/50 - 1/200.
ELISA Use at an assay dependent concentration.
IHC-P 1/20 - 1/200.

Target

  • Function
    Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Alpha chain antibody
    • Fc fragment of IgG, receptor transporter, alpha antibody
    • FCGRN_HUMAN antibody
    • FCGRT antibody
    • FcRn alpha chain antibody
    • FcRn antibody
    • FCRN, alpha chain antibody
    • IgG Fc fragment receptor transporter alpha chain antibody
    • IgG Gc receptor antibody
    • IgG receptor FcRn large subunit p51 antibody
    • IgG receptor FcRn large subunit p51 precursor antibody
    • Immunoglobulin receptor, intestinal, heavy chain antibody
    • Neonatal Fc receptor antibody
    see all

Images

  • All lanes : Anti-FCGRT antibody - Extracellular domain (ab193148) at 2 µg

    Lane 1 : HepG2 whole cell lysate
    Lane 2 : Mouse liver tissue
    Lane 3 : Mouse spleen tissue
    Lane 4 : A549 whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/1000 dilution

    Predicted band size: 40 kDa
    Observed band size: 40 kDa

  • All lanes : Anti-FCGRT antibody - Extracellular domain (ab193148) at 5.3 µg/ml

    Lane 1 : Mouse liver tissue lysate
    Lane 2 : Mouse kidney tissue lysate

    Secondary
    All lanes : Polyclonal goat anti-rabbit IgG at 1/10000 dilution

    Predicted band size: 40 kDa
    Observed band size: 39 kDa (why is the actual band size different from the predicted?)

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human placenta tissue labelling FCGRT with ab193148 at a dilution of 1/100.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pancreatic cancer tissue labelling FCGRT with ab193148 at a dilution of 1/100.

  • Immunocytochemistry/Immunofluorscence analysis of HepG2 cells labelling FCGRT with ab193148 at a dilution of 1/100. An Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L) was used as the secondary antibody.

References

ab193148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up