Overview

  • Product nameAnti-FCN1 antibody
    See all FCN1 primary antibodies
  • Description
    Rabbit polyclonal to FCN1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 215-264 (

    HQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDND

    ) of Human FCN1 (NP_001994).

  • Positive control
    • Human Placenta Lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab108284 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionInvolved in serum exerting lectin activity. Binds GlcNAc.
  • Tissue specificityPeripheral blood leukocytes. Also detected in spleen, lung, and thymus, may be due to the presence of tissue macrophages or trapped blood in these tissues. Not detected on lymphocytes and granulocytes.
  • Sequence similaritiesBelongs to the ficolin lectin family.
    Contains 1 collagen-like domain.
    Contains 1 fibrinogen C-terminal domain.
  • Cellular localizationSecreted. Found on the monocyte surface.
  • Information by UniProt
  • Database links
  • Alternative names
    • Collagen/fibrinogen domain containing protein 1 antibody
    • Collagen/fibrinogen domain-containing protein 1 antibody
    • Fcn1 antibody
    • FCN1_HUMAN antibody
    • FCNM antibody
    • ficolin (collagen/fibrinogen domain containing) 1 antibody
    • Ficolin 1 antibody
    • Ficolin A antibody
    • Ficolin alpha antibody
    • Ficolin-1 antibody
    • Ficolin-A antibody
    • Ficolin-alpha antibody
    • M ficolin antibody
    • M-ficolin antibody
    see all

Anti-FCN1 antibody images

  • Anti-FCN1 antibody (ab108284) at 1 µg/ml + Human Placenta Lysate at 10 µg

    Predicted band size : 35 kDa

References for Anti-FCN1 antibody (ab108284)

ab108284 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108284.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"