Overview

  • Product nameAnti-FCRL6 antibody
    See all FCRL6 primary antibodies
  • Description
    Rabbit polyclonal to FCRL6
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cat
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 143-192 (

    LRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQ

    ) of Human FCRL6 (NP_001004310).

  • Positive control
    • OVCAR3 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99108 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 48 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Tissue specificityExpressed by cytolytic cells including NK cells, effector and effector-memory CD8+ T-cells. Expression among T-cells is greatly expanded in HIV-1 infected individuals, and includes not only effector and effector-memory CD8+ T-cells but also populations of CD4+ T-cells.
  • Sequence similaritiesContains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • DomainContains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). The phosphorylated ITIM motif is involved in PTPN11 binding.
  • Post-translational
    modifications
    Phosphorylated on Tyr residue, inducing association with PTPN11.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Fc receptor homolog 6 antibody
    • Fc receptor-like 6 antibody
    • Fc receptor-like protein 6 antibody
    • Fc receptor-like protein 7 antibody
    • FcR-like protein 6 antibody
    • FcRH6 antibody
    • FcRL6 antibody
    • FCRL6_HUMAN antibody
    • FLJ16056 antibody
    • IFGP6 antibody
    • IgSF type I transmembrane receptor antibody
    • leukocyte receptor antibody
    see all

Anti-FCRL6 antibody images

  • Anti-FCRL6 antibody (ab99108) at 1 µg/ml + OVCAR3 Cell Lysate at 10 µg

    Predicted band size : 48 kDa

References for Anti-FCRL6 antibody (ab99108)

ab99108 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99108.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"