Overview

  • Product nameAnti-Ferritin Heavy Chain antibody
    See all Ferritin Heavy Chain primary antibodies
  • Description
    Rabbit polyclonal to Ferritin Heavy Chain
  • Tested applicationsSuitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human Ferritin Heavy Chain aa 108-157 (internal sequence).
    Sequence:

    EKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLR


    Database link: P02794

  • Positive control
    • Jurket Cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab81444 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 21 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 5 µg/ml.

Target

Anti-Ferritin Heavy Chain antibody images



  • Predicted band size : 21 kDa
    Western blot analysis of Human fetal lung tissue lysate labeling Ferritin Heavy Chain with ab81444 at 1.0µg/ml


  • Predicted band size : 21 kDa
    Western blot analysis of HeLa cell lysate labeling Ferritin Heavy Chain with ab81444 at 1.0µg/ml
  • Anti-Ferritin Heavy Chain antibody (ab81444) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat Cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 21 kDa
    Observed band size : 27 kDa (why is the actual band size different from the predicted?)
    Gel concentration: 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling Ferritin Heavy Chain with ab81444 at 5 µg/ml.

References for Anti-Ferritin Heavy Chain antibody (ab81444)

This product has been referenced in:
  • Colafrancesco S  et al. sCD163 in AOSD: a biomarker for macrophage activation related to hyperferritinemia. Immunol Res 60:177-83 (2014). Read more (PubMed: 25388964) »
  • Asensio-López MC  et al. Involvement of ferritin heavy chain in the preventive effect of metformin against doxorubicin-induced cardiotoxicity. Free Radic Biol Med : (2012). Read more (PubMed: 23000260) »

See all 2 Publications for this product

Product Wall

We do not have any mature ferritin binding data for the rabbit or chicken polyclonals, or any of the other heavy chain ferritin antibodies. We do, however, have kidney IHC data for the rabbit polyclonal, which suggests it is binding mature ferritin, as...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"