Overview

  • Product name
  • Description
    Rabbit polyclonal to FFAR3
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FFAR3 aa 286-343.
    Sequence:

    DFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGC GTGGQVAC


    Database link: O14843

  • Positive control
    • IHC-P: Human small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Receptor for short chain fatty acids. The activity of this receptor is coupled to the formation of inositol 1,4,5-trisphosphate, intracellular Ca2+ mobilization, the activation of ERK 1/2 and inhibition of intracellular cAMP accumulation. Coupled exclusively to the pertussis toxin-sensitive G(i/o)-alpha protein. The rank order of potency for agonists of this receptor is propionate = pentanoate = butyrate > acetate > formate.
  • Tissue specificity
    Highest level in adipose tissue, and lower expression across all tissues tested.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • FFA3R antibody
    • Ffar3 antibody
    • FFAR3_HUMAN antibody
    • Free fatty acid receptor 3 antibody
    • G protein coupled receptor 41 antibody
    • G-protein coupled receptor 41 antibody
    • gpcr41 antibody
    • GPR41 antibody
    • gpr42 antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for FFAR3 using ab224568 at 1/500 dilution in immunohistochemical analysis.

References

ab224568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up