Overview

  • Product name
    Anti-FGD5 antibody - C-terminal
    See all FGD5 primary antibodies
  • Description
    Rabbit polyclonal to FGD5 - C-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Cat, Dog
  • Immunogen

    Synthetic peptide within Human FGD5 aa 463-512 (C terminal). The exact sequence is proprietary.
    Sequence:

    FVIKGKVLYTYMASEDKVALESMPLLGFTIAPEKEEGSSEVGPIFHLYHK


    Database link: Q6ZNL6-2

  • Positive control
    • U937 whole cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab178030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 61 kDa.

Target

  • Relevance
    FGD5 may activate CDC42, a member of the Ras like family of Rho and Rac proteins, by exchanging bound GDP for free GTP. It may also play a role in regulating the actin cytoskeleton and cell shape. FGD5 contains one DH (DBL-homology) domain one FYVE type zinc finger and two PH domains. There are two isoforms.
  • Cellular localization
    Cytoplasm, cytoskeleton
  • Database links
  • Alternative names
    • FYVE, RhoGEF and PH domain containing protein 5 antibody
    • ZFYVE23 antibody
    • Zinc finger FYVE domain containing protein 23 antibody

Images

  • Anti-FGD5 antibody - C-terminal (ab178030) at 1 µg/ml + U937 whole cell lysate at 10 µg

    Predicted band size : 61 kDa

References

ab178030 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178030.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up