Overview

  • Product name
  • Description
    Mouse polyclonal to FGF19
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human FGF19 aa 1-216.
    Sequence:

    MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTS GPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRY LCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQ RQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPF GLVTGLEAVRSPSFEK


    Database link: NP_005108.1

  • Positive control
    • FGF19 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172545 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa.

Target

  • Function
    Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB.
  • Tissue specificity
    Expressed in fetal brain, cartilage, retina, and adult gall bladder.
  • Sequence similarities
    Belongs to the heparin-binding growth factors family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • FGF 19 antibody
    • FGF-19 antibody
    • FGF15 antibody
    • FGF19 antibody
    • FGF19_HUMAN antibody
    • Fibroblast growth factor 15 antibody
    • Fibroblast growth factor 19 antibody
    see all

Images

  • All lanes : Anti-FGF19 antibody (ab172545) at 1 µg/ml

    Lane 1 : FGF19 transfected 293T cell lysate
    Lane 2 : Non transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Predicted band size : 24 kDa

References

ab172545 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172545.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up