Overview

  • Product name
    Anti-FILIP1 antibody
  • Description
    Rabbit polyclonal to FILIP1
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human FILIP1 aa 767-848.
    Sequence:

    QEVLNLTKELELSKRYSRALRPSVNGRRMVDVPVTSTGVQTDAVSGEAAE EETPAVFIRKSFQEENHIMSNLRQVGLKKPVE


    Database link: Q7Z7B0

  • Positive control
    • Human heat muscle, liver and testis cancer tissues.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab188157 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    By acting through a filamin-A/F-actin axis, it controls the start of neocortical cell migration from the ventricular zone. May be able to induce the degradation of filamin-A.
  • Tissue specificity
    Moderately expressed in adult heart and brain. Weakly expressed in lung, skeletal muscle, ovary, testis, kidney, and fetal brain, and hardly detectable in liver, pancreas, spleen, and fetal liver. Within brain, moderate expression is found in amygdala and caudate nucleus.
  • Sequence similarities
    Belongs to the FILIP1 family.
  • Information by UniProt
  • Database links
  • Alternative names
    • Filamin-A-interacting protein 1 antibody
    • FILIP antibody
    • FILIP1 antibody
    • FLIP1_HUMAN antibody

Images

  • Immunohistochemical analysis of paraffin embedded Human heart muscle tissue sections labeling FILIP1 using ab188157 at a 1/500 dilution.

  • Immunohistochemical analysis of paraffin embedded Human liver tissue sections labeling FILIP1 using ab188157 at a 1/500 dilution.

  • Immunohistochemical analysis of paraffin embedded Human testis cancer tissue sections labeling FILIP1 using ab188157 at a 1/500 dilution.

References

ab188157 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188157.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up