Overview

  • Product name
  • Description
    Rabbit polyclonal to FKBP12
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human FKBP12 aa 1-108.
    Sequence:

    MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFM LGKQEVIRGWE EGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATL VFDVELLKLE


    Database link: P62942

  • Positive control
    • Mouse cerebellum tissue extract.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 12 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function
    May play a role in modulation of ryanodine receptor isoform-1 (RYR-1), a component of the calcium release channel of skeletal muscle sarcoplasmic reticulum. There are four molecules of FKBP12 per skeletal muscle RYR. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Sequence similarities
    Belongs to the FKBP-type PPIase family. FKBP1 subfamily.
    Contains 1 PPIase FKBP-type domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • 12 kDa FK506-binding protein antibody
    • 12 kDa FKBP antibody
    • Calstabin 1 antibody
    • FK506 binding protein 1 antibody
    • FK506 binding protein 12 antibody
    • FK506 binding protein 1A (12kD) antibody
    • FK506 binding protein 1A 12kDa antibody
    • FK506 binding protein 1A antibody
    • FK506 binding protein T cell 12 kD antibody
    • FK506 binding protein, T cell, 12 kD antibody
    • FK506 binding protein12 antibody
    • FK506-binding protein 1A antibody
    • FKB1A_HUMAN antibody
    • FKBP 12 antibody
    • FKBP 1A antibody
    • FKBP-12 antibody
    • FKBP-1A antibody
    • FKBP1 antibody
    • FKBP12 antibody
    • FKBP12 Exip3 antibody
    • FKBP12C antibody
    • fkbp1a antibody
    • Immunophilin FKBP12 antibody
    • Peptidyl prolyl cis trans isomerase antibody
    • Peptidyl-prolyl cis-trans isomerase FKBP1A antibody
    • PKC12 antibody
    • PKCI2 antibody
    • PPIase antibody
    • PPIase FKBP1A antibody
    • Protein kinase C inhibitor 2 antibody
    • Rotamase antibody
    see all

Images

  • Anti-FKBP12 antibody (ab180758) at 1/500 dilution + Mouse cerebellum tissue extract

    Predicted band size: 12 kDa

References

ab180758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up